Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for cinnamonkitty 81. cinnamonkitty Lv 1 2 pts. 9,005
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 2 pts. 9,004
  3. Avatar for Merf 83. Merf Lv 1 2 pts. 8,979
  4. Avatar for antibot215 84. antibot215 Lv 1 2 pts. 8,958
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 1 pt. 8,946
  6. Avatar for navn 86. navn Lv 1 1 pt. 8,932
  7. Avatar for hada 87. hada Lv 1 1 pt. 8,927
  8. Avatar for gurch 88. gurch Lv 1 1 pt. 8,844
  9. Avatar for Vincera 89. Vincera Lv 1 1 pt. 8,797
  10. Avatar for stomjoh 90. stomjoh Lv 1 1 pt. 8,726

Comments