Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for Glen B
    1. Glen B Lv 1
    100 pts. 11,156
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 97 pts. 10,914
  3. Avatar for bertro 3. bertro Lv 1 94 pts. 10,878
  4. Avatar for crpainter 4. crpainter Lv 1 90 pts. 10,836
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 87 pts. 10,758
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 10,753
  7. Avatar for frood66 7. frood66 Lv 1 81 pts. 10,729
  8. Avatar for mirp 8. mirp Lv 1 78 pts. 10,728
  9. Avatar for Galaxie 9. Galaxie Lv 1 75 pts. 10,722
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 73 pts. 10,707

Comments