Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,884
  2. Avatar for Contenders 2. Contenders 73 pts. 10,836
  3. Avatar for Go Science 3. Go Science 52 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,758
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 10,722
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,658
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 10,654
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,573
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,885
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,512

  1. Avatar for Glen B
    1. Glen B Lv 1
    100 pts. 11,156
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 97 pts. 10,914
  3. Avatar for bertro 3. bertro Lv 1 94 pts. 10,878
  4. Avatar for crpainter 4. crpainter Lv 1 90 pts. 10,836
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 87 pts. 10,758
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 10,753
  7. Avatar for frood66 7. frood66 Lv 1 81 pts. 10,729
  8. Avatar for mirp 8. mirp Lv 1 78 pts. 10,728
  9. Avatar for Galaxie 9. Galaxie Lv 1 75 pts. 10,722
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 73 pts. 10,707

Comments