Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,884
  2. Avatar for Contenders 2. Contenders 73 pts. 10,836
  3. Avatar for Go Science 3. Go Science 52 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,758
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 10,722
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,658
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 10,654
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,573
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,885
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,512

  1. Avatar for SaraL 91. SaraL Lv 1 1 pt. 9,149
  2. Avatar for Auntecedent 92. Auntecedent Lv 1 1 pt. 9,128
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 1 pt. 9,123
  4. Avatar for GaryForbis 94. GaryForbis Lv 1 1 pt. 9,106
  5. Avatar for Deleted player 95. Deleted player pts. 9,106
  6. Avatar for alrianne 96. alrianne Lv 1 1 pt. 9,102
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 1 pt. 9,099
  8. Avatar for jebbiek 98. jebbiek Lv 1 1 pt. 9,075
  9. Avatar for fwadwani 99. fwadwani Lv 1 1 pt. 9,060
  10. Avatar for SouperGenious 100. SouperGenious Lv 1 1 pt. 9,040

Comments