Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,884
  2. Avatar for Contenders 2. Contenders 73 pts. 10,836
  3. Avatar for Go Science 3. Go Science 52 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,758
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 10,722
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,658
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 10,654
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,573
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,885
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,512

  1. Avatar for TastyMunchies 21. TastyMunchies Lv 1 47 pts. 10,557
  2. Avatar for tarimo 22. tarimo Lv 1 45 pts. 10,540
  3. Avatar for grogar7 23. grogar7 Lv 1 44 pts. 10,537
  4. Avatar for alwen 24. alwen Lv 1 42 pts. 10,533
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 40 pts. 10,473
  6. Avatar for joremen 26. joremen Lv 1 38 pts. 10,462
  7. Avatar for Deleted player 27. Deleted player pts. 10,450
  8. Avatar for isaksson 28. isaksson Lv 1 35 pts. 10,446
  9. Avatar for diamonddays 29. diamonddays Lv 1 34 pts. 10,442
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 32 pts. 10,428

Comments