Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,123
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  5. Avatar for Deleted group 15. Deleted group pts. 5,627
  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 10,793
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 10,792
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 10,777
  4. Avatar for actiasluna 4. actiasluna Lv 1 90 pts. 10,730
  5. Avatar for grogar7 5. grogar7 Lv 1 86 pts. 10,717
  6. Avatar for Steven Pletsch 6. Steven Pletsch Lv 1 83 pts. 10,669
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 80 pts. 10,652
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 77 pts. 10,639
  9. Avatar for LociOiling 9. LociOiling Lv 1 74 pts. 10,592
  10. Avatar for frood66 10. frood66 Lv 1 71 pts. 10,525

Comments