Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622

  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 10,793
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 10,792
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 10,777
  4. Avatar for actiasluna 4. actiasluna Lv 1 90 pts. 10,730
  5. Avatar for grogar7 5. grogar7 Lv 1 86 pts. 10,717
  6. Avatar for Steven Pletsch 6. Steven Pletsch Lv 1 83 pts. 10,669
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 80 pts. 10,652
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 77 pts. 10,639
  9. Avatar for LociOiling 9. LociOiling Lv 1 74 pts. 10,592
  10. Avatar for frood66 10. frood66 Lv 1 71 pts. 10,525

Comments