Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  2. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  4. Avatar for Deleted group 15. Deleted group pts. 5,627

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,800
  2. Avatar for robgee 2. robgee Lv 1 81 pts. 10,797
  3. Avatar for mirp 3. mirp Lv 1 64 pts. 10,793
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 50 pts. 10,791
  5. Avatar for toshiue 5. toshiue Lv 1 39 pts. 10,783
  6. Avatar for lamoille 6. lamoille Lv 1 30 pts. 10,758
  7. Avatar for alwen 7. alwen Lv 1 23 pts. 10,745
  8. Avatar for Seagat2011 8. Seagat2011 Lv 1 17 pts. 10,742
  9. Avatar for alcor29 9. alcor29 Lv 1 12 pts. 10,741
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 9 pts. 10,735

Comments