Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,800
  2. Avatar for robgee 2. robgee Lv 1 81 pts. 10,797
  3. Avatar for mirp 3. mirp Lv 1 64 pts. 10,793
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 50 pts. 10,791
  5. Avatar for toshiue 5. toshiue Lv 1 39 pts. 10,783
  6. Avatar for lamoille 6. lamoille Lv 1 30 pts. 10,758
  7. Avatar for alwen 7. alwen Lv 1 23 pts. 10,745
  8. Avatar for Seagat2011 8. Seagat2011 Lv 1 17 pts. 10,742
  9. Avatar for alcor29 9. alcor29 Lv 1 12 pts. 10,741
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 9 pts. 10,735

Comments