Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for andrewxc 11. andrewxc Lv 1 6 pts. 10,733
  2. Avatar for actiasluna 12. actiasluna Lv 1 4 pts. 10,693
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 3 pts. 10,693
  4. Avatar for Blipperman 14. Blipperman Lv 1 2 pts. 10,655
  5. Avatar for LociOiling 15. LociOiling Lv 1 1 pt. 10,587
  6. Avatar for jausmh 16. jausmh Lv 1 1 pt. 10,533
  7. Avatar for JMStiffler 17. JMStiffler Lv 1 1 pt. 10,527
  8. Avatar for smilingone 18. smilingone Lv 1 1 pt. 10,252
  9. Avatar for khalan.ysatis 19. khalan.ysatis Lv 1 1 pt. 10,116
  10. Avatar for Vincera 20. Vincera Lv 1 1 pt. 10,115

Comments