Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622

  1. Avatar for rezaefar 111. rezaefar Lv 1 1 pt. 7,542
  2. Avatar for Interloper 112. Interloper Lv 1 1 pt. 7,468
  3. Avatar for Eron333 113. Eron333 Lv 1 1 pt. 7,316
  4. Avatar for Tehnologik1 114. Tehnologik1 Lv 1 1 pt. 7,083
  5. Avatar for anaserra 115. anaserra Lv 1 1 pt. 7,076
  6. Avatar for moralmar00 116. moralmar00 Lv 1 1 pt. 7,018
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 6,860
  8. Avatar for Realm999 118. Realm999 Lv 1 1 pt. 6,774
  9. Avatar for doctaven 119. doctaven Lv 1 1 pt. 6,608
  10. Avatar for retiredmichael 120. retiredmichael Lv 1 1 pt. 6,508

Comments