Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for joshmiller 131. joshmiller Lv 1 1 pt. 0
  2. Avatar for Vincera 132. Vincera Lv 1 1 pt. 0
  3. Avatar for ReallyRatherDumb 133. ReallyRatherDumb Lv 1 1 pt. 0
  4. Avatar for Rienoer 134. Rienoer Lv 1 1 pt. 0

Comments