Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,861
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 10,857
  3. Avatar for TastyMunchies 3. TastyMunchies Lv 1 94 pts. 10,802
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 10,802
  5. Avatar for nicobul 5. nicobul Lv 1 87 pts. 10,790
  6. Avatar for Seagat2011 6. Seagat2011 Lv 1 84 pts. 10,784
  7. Avatar for grogar7 7. grogar7 Lv 1 81 pts. 10,782
  8. Avatar for mirp 8. mirp Lv 1 78 pts. 10,760
  9. Avatar for bertro 9. bertro Lv 1 75 pts. 10,750
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 72 pts. 10,728

Comments