Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,861
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 10,857
  3. Avatar for TastyMunchies 3. TastyMunchies Lv 1 94 pts. 10,802
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 10,802
  5. Avatar for nicobul 5. nicobul Lv 1 87 pts. 10,790
  6. Avatar for Seagat2011 6. Seagat2011 Lv 1 84 pts. 10,784
  7. Avatar for grogar7 7. grogar7 Lv 1 81 pts. 10,782
  8. Avatar for mirp 8. mirp Lv 1 78 pts. 10,760
  9. Avatar for bertro 9. bertro Lv 1 75 pts. 10,750
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 72 pts. 10,728

Comments