Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  4. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  5. Avatar for freefolder 16. freefolder 1 pt. 9,541
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,862
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 82 pts. 10,861
  3. Avatar for Hollinas 3. Hollinas Lv 1 66 pts. 10,861
  4. Avatar for toshiue 4. toshiue Lv 1 53 pts. 10,857
  5. Avatar for mirp 5. mirp Lv 1 42 pts. 10,844
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 33 pts. 10,840
  7. Avatar for sciencewalker 7. sciencewalker Lv 1 26 pts. 10,838
  8. Avatar for Galaxie 8. Galaxie Lv 1 20 pts. 10,801
  9. Avatar for robgee 9. robgee Lv 1 15 pts. 10,785
  10. Avatar for lamoille 10. lamoille Lv 1 11 pts. 10,783

Comments