Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for doctaven 121. doctaven Lv 1 1 pt. 9,531
  2. Avatar for Eron333 122. Eron333 Lv 1 1 pt. 9,522
  3. Avatar for Auntecedent 123. Auntecedent Lv 1 1 pt. 9,515
  4. Avatar for Bithalbierer 124. Bithalbierer Lv 1 1 pt. 9,502
  5. Avatar for SaraL 125. SaraL Lv 1 1 pt. 9,450
  6. Avatar for Rienoer 126. Rienoer Lv 1 1 pt. 9,408
  7. Avatar for Senjer 127. Senjer Lv 1 1 pt. 9,245
  8. Avatar for multaq 128. multaq Lv 1 1 pt. 9,217
  9. Avatar for MinLi 129. MinLi Lv 1 1 pt. 8,156
  10. Avatar for Realm999 130. Realm999 Lv 1 1 pt. 7,883

Comments