Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for crpainter 11. crpainter Lv 1 70 pts. 10,719
  2. Avatar for dam_01 12. dam_01 Lv 1 67 pts. 10,715
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 65 pts. 10,715
  4. Avatar for frood66 14. frood66 Lv 1 62 pts. 10,693
  5. Avatar for YeshuaLives 15. YeshuaLives Lv 1 60 pts. 10,692
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 57 pts. 10,690
  7. Avatar for tarimo 17. tarimo Lv 1 55 pts. 10,674
  8. Avatar for LociOiling 18. LociOiling Lv 1 53 pts. 10,666
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 51 pts. 10,651
  10. Avatar for O Seki To 20. O Seki To Lv 1 49 pts. 10,627

Comments