Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for carsonfb 41. carsonfb Lv 1 19 pts. 10,496
  2. Avatar for cbwest 42. cbwest Lv 1 18 pts. 10,490
  3. Avatar for toshiue 43. toshiue Lv 1 18 pts. 10,481
  4. Avatar for actiasluna 44. actiasluna Lv 1 17 pts. 10,468
  5. Avatar for DoctorSockrates 45. DoctorSockrates Lv 1 16 pts. 10,462
  6. Avatar for guineapig 46. guineapig Lv 1 15 pts. 10,430
  7. Avatar for diamonddays 47. diamonddays Lv 1 14 pts. 10,427
  8. Avatar for Norrjane 48. Norrjane Lv 1 14 pts. 10,413
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 13 pts. 10,408
  10. Avatar for joremen 50. joremen Lv 1 12 pts. 10,388

Comments