Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for cobaltteal 51. cobaltteal Lv 1 12 pts. 10,387
  2. Avatar for NinjaGreg 52. NinjaGreg Lv 1 11 pts. 10,386
  3. Avatar for frostschutz 53. frostschutz Lv 1 11 pts. 10,376
  4. Avatar for rezaefar 54. rezaefar Lv 1 10 pts. 10,363
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 9 pts. 10,340
  6. Avatar for Deleted player 56. Deleted player pts. 10,329
  7. Avatar for Vinara 57. Vinara Lv 1 8 pts. 10,321
  8. Avatar for alwen 58. alwen Lv 1 8 pts. 10,317
  9. Avatar for stomjoh 59. stomjoh Lv 1 8 pts. 10,314
  10. Avatar for sciencewalker 60. sciencewalker Lv 1 7 pts. 10,314

Comments