Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for alyssa_d 61. alyssa_d Lv 1 7 pts. 10,302
  2. Avatar for silent gene 62. silent gene Lv 1 6 pts. 10,292
  3. Avatar for alcor29 63. alcor29 Lv 1 6 pts. 10,270
  4. Avatar for manu8170 64. manu8170 Lv 1 6 pts. 10,268
  5. Avatar for isaksson 65. isaksson Lv 1 5 pts. 10,252
  6. Avatar for ourtown 66. ourtown Lv 1 5 pts. 10,243
  7. Avatar for Vincera 67. Vincera Lv 1 5 pts. 10,218
  8. Avatar for mitarcher 68. mitarcher Lv 1 4 pts. 10,211
  9. Avatar for jobo0502 69. jobo0502 Lv 1 4 pts. 10,210
  10. Avatar for joaniegirl 70. joaniegirl Lv 1 4 pts. 10,157

Comments