Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302
  1. Avatar for reefyrob 21. reefyrob Lv 1 47 pts. 10,618
  2. Avatar for Blipperman 22. Blipperman Lv 1 45 pts. 10,603
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 43 pts. 10,593
  4. Avatar for robgee 24. robgee Lv 1 42 pts. 10,591
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 40 pts. 10,588
  6. Avatar for katling 26. katling Lv 1 38 pts. 10,582
  7. Avatar for MicElephant 27. MicElephant Lv 1 37 pts. 10,580
  8. Avatar for Flagg65a 28. Flagg65a Lv 1 35 pts. 10,578
  9. Avatar for johnmitch 29. johnmitch Lv 1 34 pts. 10,575
  10. Avatar for gdnskye 30. gdnskye Lv 1 32 pts. 10,571

Comments