Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,216
  2. Avatar for Deleted player 2. Deleted player pts. 11,201
  3. Avatar for lamoille 3. lamoille Lv 1 65 pts. 11,194
  4. Avatar for robgee 4. robgee Lv 1 52 pts. 11,186
  5. Avatar for phi16 5. phi16 Lv 1 41 pts. 11,185
  6. Avatar for jausmh 6. jausmh Lv 1 32 pts. 11,182
  7. Avatar for Seagat2011 7. Seagat2011 Lv 1 24 pts. 11,181
  8. Avatar for LociOiling 8. LociOiling Lv 1 18 pts. 11,175
  9. Avatar for smilingone 9. smilingone Lv 1 14 pts. 11,173
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 10 pts. 11,096

Comments