Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for Deleted player pts. 11,212
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 11,171
  3. Avatar for johnmitch 3. johnmitch Lv 1 94 pts. 11,171
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 11,170
  5. Avatar for O Seki To 5. O Seki To Lv 1 87 pts. 11,155
  6. Avatar for frood66 6. frood66 Lv 1 84 pts. 11,153
  7. Avatar for LociOiling 7. LociOiling Lv 1 81 pts. 11,152
  8. Avatar for ReallyRatherDumb 8. ReallyRatherDumb Lv 1 78 pts. 11,108
  9. Avatar for Galaxie 9. Galaxie Lv 1 76 pts. 11,083
  10. Avatar for grogar7 10. grogar7 Lv 1 73 pts. 11,080

Comments