Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for martinf 91. martinf Lv 1 1 pt. 10,015
  2. Avatar for Klamz 92. Klamz Lv 1 1 pt. 9,956
  3. Avatar for spritz1992 93. spritz1992 Lv 1 1 pt. 9,934
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,933
  5. Avatar for phi16 95. phi16 Lv 1 1 pt. 9,913
  6. Avatar for InfoManiac742 96. InfoManiac742 Lv 1 1 pt. 9,904
  7. Avatar for Anamfija 97. Anamfija Lv 1 1 pt. 9,861
  8. Avatar for gurch 98. gurch Lv 1 1 pt. 9,838
  9. Avatar for alyssa_d 99. alyssa_d Lv 1 1 pt. 9,832
  10. Avatar for gimba 100. gimba Lv 1 1 pt. 9,826

Comments