Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for trebach 101. trebach Lv 1 1 pt. 9,814
  2. Avatar for parsnip 102. parsnip Lv 1 1 pt. 9,805
  3. Avatar for NotJim99 103. NotJim99 Lv 1 1 pt. 9,796
  4. Avatar for anaserra 104. anaserra Lv 1 1 pt. 9,787
  5. Avatar for SouperGenious 105. SouperGenious Lv 1 1 pt. 9,763
  6. Avatar for larry25427 106. larry25427 Lv 1 1 pt. 9,728
  7. Avatar for ManVsYard 107. ManVsYard Lv 1 1 pt. 9,711
  8. Avatar for ivalnic 108. ivalnic Lv 1 1 pt. 9,700
  9. Avatar for Knoblerine 109. Knoblerine Lv 1 1 pt. 9,682
  10. Avatar for rinze 110. rinze Lv 1 1 pt. 9,666

Comments