Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for izzgood 111. izzgood Lv 1 1 pt. 9,661
  2. Avatar for lconor 112. lconor Lv 1 1 pt. 9,631
  3. Avatar for Jiessie 113. Jiessie Lv 1 1 pt. 9,606
  4. Avatar for chrisb41 114. chrisb41 Lv 1 1 pt. 9,590
  5. Avatar for momadoc 115. momadoc Lv 1 1 pt. 9,585
  6. Avatar for jiangzhu 116. jiangzhu Lv 1 1 pt. 9,579
  7. Avatar for veranka00 117. veranka00 Lv 1 1 pt. 9,577
  8. Avatar for Emma Limonta 118. Emma Limonta Lv 1 1 pt. 9,534
  9. Avatar for DipsyDoodle2016 119. DipsyDoodle2016 Lv 1 1 pt. 9,521
  10. Avatar for Momo liu 120. Momo liu Lv 1 1 pt. 9,507

Comments