Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for doctaven 121. doctaven Lv 1 1 pt. 9,506
  2. Avatar for sonounragazzocarino 122. sonounragazzocarino Lv 1 1 pt. 9,495
  3. Avatar for Fblaze1 123. Fblaze1 Lv 1 1 pt. 9,343
  4. Avatar for Flash_76 124. Flash_76 Lv 1 1 pt. 9,322
  5. Avatar for Carrie_W 125. Carrie_W Lv 1 1 pt. 9,292
  6. Avatar for Ciocie053 126. Ciocie053 Lv 1 1 pt. 9,289
  7. Avatar for Tonyoo 127. Tonyoo Lv 1 1 pt. 9,247
  8. Avatar for nettieboo 128. nettieboo Lv 1 1 pt. 9,217
  9. Avatar for Simeon_C 129. Simeon_C Lv 1 1 pt. 9,143
  10. Avatar for hexidecimalhack 130. hexidecimalhack Lv 1 1 pt. 9,110

Comments