Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for mattiameroni 131. mattiameroni Lv 1 1 pt. 9,091
  2. Avatar for Gahmeir 132. Gahmeir Lv 1 1 pt. 9,001
  3. Avatar for JMStiffler 133. JMStiffler Lv 1 1 pt. 8,800
  4. Avatar for tegoni 134. tegoni Lv 1 1 pt. 8,746
  5. Avatar for Rafaello9595 135. Rafaello9595 Lv 1 1 pt. 8,452
  6. Avatar for gautieri 136. gautieri Lv 1 1 pt. 8,378
  7. Avatar for Anton_K 137. Anton_K Lv 1 1 pt. 8,251
  8. Avatar for JohThe 138. JohThe Lv 1 1 pt. 8,013
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 7,433
  10. Avatar for josh00 140. josh00 Lv 1 1 pt. 6,983

Comments