Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for Norrjane 11. Norrjane Lv 1 70 pts. 11,078
  2. Avatar for mirp 12. mirp Lv 1 68 pts. 11,068
  3. Avatar for crpainter 13. crpainter Lv 1 65 pts. 11,063
  4. Avatar for nicobul 14. nicobul Lv 1 63 pts. 11,060
  5. Avatar for Seagat2011 15. Seagat2011 Lv 1 60 pts. 11,058
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 58 pts. 11,055
  7. Avatar for AtOneMent 17. AtOneMent Lv 1 56 pts. 11,052
  8. Avatar for Aubade01 18. Aubade01 Lv 1 54 pts. 11,025
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 52 pts. 11,023
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 50 pts. 11,018

Comments