Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983

  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 48 pts. 11,013
  2. Avatar for matosfran 22. matosfran Lv 1 46 pts. 10,990
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 44 pts. 10,956
  4. Avatar for khalan.ysatis 24. khalan.ysatis Lv 1 42 pts. 10,910
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 41 pts. 10,897
  6. Avatar for robgee 26. robgee Lv 1 39 pts. 10,885
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 37 pts. 10,859
  8. Avatar for stomjoh 28. stomjoh Lv 1 36 pts. 10,855
  9. Avatar for smilingone 29. smilingone Lv 1 34 pts. 10,851
  10. Avatar for joaniegirl 30. joaniegirl Lv 1 33 pts. 10,850

Comments