Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 10,335
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,271
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,832
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,661
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 9,506
  6. Avatar for Deleted group 16. Deleted group pts. 9,292
  7. Avatar for Window Group 17. Window Group 1 pt. 6,983
  1. Avatar for pfirth 51. pfirth Lv 1 12 pts. 10,571
  2. Avatar for jobo0502 52. jobo0502 Lv 1 12 pts. 10,568
  3. Avatar for Flagg65a 53. Flagg65a Lv 1 11 pts. 10,566
  4. Avatar for Merf 54. Merf Lv 1 11 pts. 10,497
  5. Avatar for MicElephant 55. MicElephant Lv 1 10 pts. 10,488
  6. Avatar for Superphosphate 56. Superphosphate Lv 1 10 pts. 10,488
  7. Avatar for petetrig 57. petetrig Lv 1 9 pts. 10,464
  8. Avatar for alcor29 58. alcor29 Lv 1 9 pts. 10,437
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 8 pts. 10,434
  10. Avatar for TedStudley 60. TedStudley Lv 1 8 pts. 10,419

Comments