Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,216
  2. Avatar for Deleted player 2. Deleted player pts. 11,201
  3. Avatar for lamoille 3. lamoille Lv 1 65 pts. 11,194
  4. Avatar for robgee 4. robgee Lv 1 52 pts. 11,186
  5. Avatar for phi16 5. phi16 Lv 1 41 pts. 11,185
  6. Avatar for jausmh 6. jausmh Lv 1 32 pts. 11,182
  7. Avatar for Seagat2011 7. Seagat2011 Lv 1 24 pts. 11,181
  8. Avatar for LociOiling 8. LociOiling Lv 1 18 pts. 11,175
  9. Avatar for smilingone 9. smilingone Lv 1 14 pts. 11,173
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 10 pts. 11,096

Comments