Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for Blipperman 11. Blipperman Lv 1 7 pts. 11,090
  2. Avatar for ManVsYard 12. ManVsYard Lv 1 5 pts. 11,085
  3. Avatar for Hollinas 13. Hollinas Lv 1 4 pts. 11,075
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 3 pts. 11,075
  5. Avatar for toshiue 15. toshiue Lv 1 2 pts. 11,070
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 1 pt. 11,069
  7. Avatar for khalan.ysatis 17. khalan.ysatis Lv 1 1 pt. 11,032
  8. Avatar for nicobul 18. nicobul Lv 1 1 pt. 10,928
  9. Avatar for mirp 19. mirp Lv 1 1 pt. 10,923
  10. Avatar for JMStiffler 20. JMStiffler Lv 1 1 pt. 10,912

Comments