Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for martinf 91. martinf Lv 1 1 pt. 10,015
  2. Avatar for Klamz 92. Klamz Lv 1 1 pt. 9,956
  3. Avatar for spritz1992 93. spritz1992 Lv 1 1 pt. 9,934
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 9,933
  5. Avatar for phi16 95. phi16 Lv 1 1 pt. 9,913
  6. Avatar for InfoManiac742 96. InfoManiac742 Lv 1 1 pt. 9,904
  7. Avatar for Anamfija 97. Anamfija Lv 1 1 pt. 9,861
  8. Avatar for gurch 98. gurch Lv 1 1 pt. 9,838
  9. Avatar for alyssa_d 99. alyssa_d Lv 1 1 pt. 9,832
  10. Avatar for gimba 100. gimba Lv 1 1 pt. 9,826

Comments