Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for izzgood 111. izzgood Lv 1 1 pt. 9,661
  2. Avatar for lconor 112. lconor Lv 1 1 pt. 9,631
  3. Avatar for Jiessie 113. Jiessie Lv 1 1 pt. 9,606
  4. Avatar for chrisb41 114. chrisb41 Lv 1 1 pt. 9,590
  5. Avatar for momadoc 115. momadoc Lv 1 1 pt. 9,585
  6. Avatar for jiangzhu 116. jiangzhu Lv 1 1 pt. 9,579
  7. Avatar for veranka00 117. veranka00 Lv 1 1 pt. 9,577
  8. Avatar for Emma Limonta 118. Emma Limonta Lv 1 1 pt. 9,534
  9. Avatar for DipsyDoodle2016 119. DipsyDoodle2016 Lv 1 1 pt. 9,521
  10. Avatar for Momo liu 120. Momo liu Lv 1 1 pt. 9,507

Comments