Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for Norrjane 11. Norrjane Lv 1 70 pts. 11,078
  2. Avatar for mirp 12. mirp Lv 1 68 pts. 11,068
  3. Avatar for crpainter 13. crpainter Lv 1 65 pts. 11,063
  4. Avatar for nicobul 14. nicobul Lv 1 63 pts. 11,060
  5. Avatar for Seagat2011 15. Seagat2011 Lv 1 60 pts. 11,058
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 58 pts. 11,055
  7. Avatar for AtOneMent 17. AtOneMent Lv 1 56 pts. 11,052
  8. Avatar for Aubade01 18. Aubade01 Lv 1 54 pts. 11,025
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 52 pts. 11,023
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 50 pts. 11,018

Comments