1539: Revisiting Puzzle 71: Crystallin
Closed since almost 8 years ago
Intermediate Overall PredictionSummary
- Created
- June 23, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE
Top groups
-
100 pts. 11,216
-
-
-
-
-
-
-
-
-
Comments