Placeholder image of a protein
Icon representing a puzzle

1539: Revisiting Puzzle 71: Crystallin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,216
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 11,182
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,175
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 11,171
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 11,155
  6. Avatar for Go Science 6. Go Science 16 pts. 11,108
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,090
  8. Avatar for Contenders 8. Contenders 6 pts. 11,063
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,060
  10. Avatar for Cannabis Crew 10. Cannabis Crew 2 pts. 10,595

  1. Avatar for Blipperman 41. Blipperman Lv 1 20 pts. 10,701
  2. Avatar for toshiue 42. toshiue Lv 1 19 pts. 10,660
  3. Avatar for weitzen 43. weitzen Lv 1 18 pts. 10,653
  4. Avatar for isaksson 44. isaksson Lv 1 17 pts. 10,630
  5. Avatar for Tehnologik1 45. Tehnologik1 Lv 1 17 pts. 10,630
  6. Avatar for katling 46. katling Lv 1 16 pts. 10,617
  7. Avatar for joremen 47. joremen Lv 1 15 pts. 10,614
  8. Avatar for mitarcher 48. mitarcher Lv 1 14 pts. 10,612
  9. Avatar for Lord_c_nu 49. Lord_c_nu Lv 1 14 pts. 10,595
  10. Avatar for ourtown 50. ourtown Lv 1 13 pts. 10,588

Comments