Placeholder image of a protein
Icon representing a puzzle

1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate

Summary


Created
July 02, 2018
Expires
Max points
100
Description

Note: This puzzle was closed early due to a missing filter file resulting in no bonuses being received for forming disulfide bonds. It is superseded by Puzzle 1542b. Players may load their work from this puzzle into the reposted puzzle.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 9,204
  2. Avatar for Go Science 2. Go Science 60 pts. 9,167
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 9,112
  4. Avatar for Beta Folders 4. Beta Folders 17 pts. 9,077
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 8,744
  6. Avatar for FoldIt@Netherlands 6. FoldIt@Netherlands 4 pts. 8,349
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 7,905
  8. Avatar for HMT heritage 8. HMT heritage 1 pt. 7,853
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 7,649
  10. Avatar for Team South Africa 10. Team South Africa 1 pt. 7,316

  1. Avatar for Timo van der Laan 100 pts. 9,204
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 88 pts. 9,167
  3. Avatar for robgee 3. robgee Lv 1 77 pts. 9,112
  4. Avatar for pvc78 4. pvc78 Lv 1 67 pts. 9,077
  5. Avatar for mirp 5. mirp Lv 1 58 pts. 9,057
  6. Avatar for ViJay7019 6. ViJay7019 Lv 1 50 pts. 8,983
  7. Avatar for silent gene 7. silent gene Lv 1 43 pts. 8,941
  8. Avatar for Deleted player 8. Deleted player pts. 8,881
  9. Avatar for sciencewalker 10. sciencewalker Lv 1 26 pts. 8,814

Comments


LociOiling Lv 1

There are four possible disulfide bridges in this puzzle, but there's no bonus for forming them.