Placeholder image of a protein
Icon representing a puzzle

1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate

Summary


Created
July 02, 2018
Expires
Max points
100
Description

Note: This puzzle was closed early due to a missing filter file resulting in no bonuses being received for forming disulfide bonds. It is superseded by Puzzle 1542b. Players may load their work from this puzzle into the reposted puzzle.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 7,160

  1. Avatar for smilingone 11. smilingone Lv 1 22 pts. 8,792
  2. Avatar for pfirth 12. pfirth Lv 1 19 pts. 8,768
  3. Avatar for dbuske 13. dbuske Lv 1 15 pts. 8,759
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 13 pts. 8,744
  5. Avatar for rinze 15. rinze Lv 1 11 pts. 8,680
  6. Avatar for tarimo 16. tarimo Lv 1 9 pts. 8,668
  7. Avatar for kludbrook 17. kludbrook Lv 1 7 pts. 8,627
  8. Avatar for Vincera 18. Vincera Lv 1 6 pts. 8,579
  9. Avatar for Jesse Pinkman 19. Jesse Pinkman Lv 1 5 pts. 8,454
  10. Avatar for LociOiling 20. LociOiling Lv 1 4 pts. 8,363

Comments


LociOiling Lv 1

There are four possible disulfide bridges in this puzzle, but there's no bonus for forming them.