Placeholder image of a protein
Icon representing a puzzle

1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate

Summary


Created
July 02, 2018
Expires
Max points
100
Description

Note: This puzzle was closed early due to a missing filter file resulting in no bonuses being received for forming disulfide bonds. It is superseded by Puzzle 1542b. Players may load their work from this puzzle into the reposted puzzle.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 7,160

  1. Avatar for Arne Heessels 31. Arne Heessels Lv 1 1 pt. 7,191
  2. Avatar for kelly_h 32. kelly_h Lv 1 1 pt. 7,160
  3. Avatar for Glen B 33. Glen B Lv 1 1 pt. 7,143
  4. Avatar for johnmitch 34. johnmitch Lv 1 1 pt. 6,956
  5. Avatar for andrewxc 35. andrewxc Lv 1 1 pt. 5,499
  6. Avatar for MicElephant 36. MicElephant Lv 1 1 pt. 0
  7. Avatar for JMStiffler 37. JMStiffler Lv 1 1 pt. 0
  8. Avatar for gdnskye 38. gdnskye Lv 1 1 pt. 0

Comments


LociOiling Lv 1

There are four possible disulfide bridges in this puzzle, but there's no bonus for forming them.