Placeholder image of a protein
Icon representing a puzzle

1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate

Summary


Created
July 02, 2018
Expires
Max points
100
Description

Note: This puzzle was closed early due to a missing filter file resulting in no bonuses being received for forming disulfide bonds. It is superseded by Puzzle 1542b. Players may load their work from this puzzle into the reposted puzzle.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 9,204
  2. Avatar for Go Science 2. Go Science 60 pts. 9,167
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 9,112
  4. Avatar for Beta Folders 4. Beta Folders 17 pts. 9,077
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 8,744
  6. Avatar for FoldIt@Netherlands 6. FoldIt@Netherlands 4 pts. 8,349
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 7,905
  8. Avatar for HMT heritage 8. HMT heritage 1 pt. 7,853
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 7,649
  10. Avatar for Team South Africa 10. Team South Africa 1 pt. 7,316

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 9,059
  2. Avatar for dbuske 2. dbuske Lv 1 4 pts. 9,018
  3. Avatar for smilingone 3. smilingone Lv 1 1 pt. 8,916

Comments


LociOiling Lv 1

There are four possible disulfide bridges in this puzzle, but there's no bonus for forming them.