Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Pilot

Summary

Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team Schleswig-Holstein 13. Team Schleswig-Holstein 1 pt. 7,778
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684
  1. Avatar for katling 111. katling Lv 1 1 pt. 6,057
  2. Avatar for Jrv211624 112. Jrv211624 Lv 1 1 pt. 5,825
  3. Avatar for doctaven 113. doctaven Lv 1 1 pt. 5,684
  4. Avatar for 01010011111 114. 01010011111 Lv 1 1 pt. 0
  5. Avatar for Anton_K 115. Anton_K Lv 1 1 pt. 0
  6. Avatar for Deleted player 116. Deleted player pts. 0
  7. Avatar for Jiessie 117. Jiessie Lv 1 1 pt. 0

Comments