Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 39 pts. 9,648
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 37 pts. 9,583
  3. Avatar for O Seki To 23. O Seki To Lv 1 35 pts. 9,563
  4. Avatar for jobo0502 24. jobo0502 Lv 1 34 pts. 9,490
  5. Avatar for isaksson 25. isaksson Lv 1 32 pts. 9,487
  6. Avatar for MicElephant 26. MicElephant Lv 1 30 pts. 9,469
  7. Avatar for alcor29 27. alcor29 Lv 1 29 pts. 9,433
  8. Avatar for YeshuaLives 28. YeshuaLives Lv 1 27 pts. 9,414
  9. Avatar for pauldunn 29. pauldunn Lv 1 26 pts. 9,389
  10. Avatar for alwen 30. alwen Lv 1 24 pts. 9,360

Comments