Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662

  1. Avatar for pfirth 41. pfirth Lv 1 13 pts. 9,130
  2. Avatar for diamonddays 42. diamonddays Lv 1 12 pts. 9,121
  3. Avatar for navn 43. navn Lv 1 11 pts. 9,087
  4. Avatar for cbwest 44. cbwest Lv 1 10 pts. 9,086
  5. Avatar for ManVsYard 45. ManVsYard Lv 1 10 pts. 9,014
  6. Avatar for SouperGenious 46. SouperGenious Lv 1 9 pts. 9,008
  7. Avatar for cobaltteal 47. cobaltteal Lv 1 9 pts. 9,005
  8. Avatar for Blipperman 48. Blipperman Lv 1 8 pts. 8,992
  9. Avatar for rezaefar 49. rezaefar Lv 1 7 pts. 8,990
  10. Avatar for nicobul 50. nicobul Lv 1 7 pts. 8,984

Comments