Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662

  1. Avatar for Knoblerine 51. Knoblerine Lv 1 6 pts. 8,980
  2. Avatar for spvincent 52. spvincent Lv 1 6 pts. 8,940
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 6 pts. 8,927
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 5 pts. 8,890
  5. Avatar for drjr 55. drjr Lv 1 5 pts. 8,885
  6. Avatar for rabamino12358 56. rabamino12358 Lv 1 5 pts. 8,861
  7. Avatar for hexidecimalhack 57. hexidecimalhack Lv 1 4 pts. 8,856
  8. Avatar for alyssajoyh 58. alyssajoyh Lv 1 4 pts. 8,855
  9. Avatar for Alistair69 59. Alistair69 Lv 1 4 pts. 8,849
  10. Avatar for kludbrook 60. kludbrook Lv 1 3 pts. 8,845

Comments