Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662

  1. Avatar for Vincera 71. Vincera Lv 1 1 pt. 8,696
  2. Avatar for InfoManiac742 72. InfoManiac742 Lv 1 1 pt. 8,695
  3. Avatar for alyssa_d 73. alyssa_d Lv 1 1 pt. 8,662
  4. Avatar for Museka 74. Museka Lv 1 1 pt. 8,596
  5. Avatar for ViJay7019 75. ViJay7019 Lv 1 1 pt. 8,580
  6. Avatar for toshiue 76. toshiue Lv 1 1 pt. 8,535
  7. Avatar for Anamfija 77. Anamfija Lv 1 1 pt. 8,527
  8. Avatar for hada 78. hada Lv 1 1 pt. 8,514
  9. Avatar for gdnskye 79. gdnskye Lv 1 1 pt. 8,509
  10. Avatar for Superphosphate 80. Superphosphate Lv 1 1 pt. 8,450

Comments