Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662
  1. Avatar for pvc78 11. pvc78 Lv 1 64 pts. 10,031
  2. Avatar for Anfinsen_slept_here 12. Anfinsen_slept_here Lv 1 61 pts. 9,999
  3. Avatar for guineapig 13. guineapig Lv 1 58 pts. 9,981
  4. Avatar for Vinara 14. Vinara Lv 1 56 pts. 9,895
  5. Avatar for crpainter 15. crpainter Lv 1 53 pts. 9,867
  6. Avatar for Idiotboy 16. Idiotboy Lv 1 51 pts. 9,854
  7. Avatar for Glen B 17. Glen B Lv 1 48 pts. 9,799
  8. Avatar for Galaxie 18. Galaxie Lv 1 46 pts. 9,781
  9. Avatar for Deleted player 19. Deleted player pts. 9,715
  10. Avatar for bertro 20. bertro Lv 1 41 pts. 9,664

Comments