1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin
Closed since over 7 years ago
Intermediate PilotSummary
- Created
- July 03, 2018
- Expires
- Max points
- 100
Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.
This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Top groups
-
100 pts. 10,405
-
-
-
-
-
-
-
-
-