Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662
  1. Avatar for momadoc 61. momadoc Lv 1 3 pts. 8,834
  2. Avatar for chrisb41 62. chrisb41 Lv 1 3 pts. 8,830
  3. Avatar for mitarcher 63. mitarcher Lv 1 3 pts. 8,802
  4. Avatar for mirjamvandelft 64. mirjamvandelft Lv 1 2 pts. 8,770
  5. Avatar for weitzen 65. weitzen Lv 1 2 pts. 8,749
  6. Avatar for NeedMoreCoffee 66. NeedMoreCoffee Lv 1 2 pts. 8,745
  7. Avatar for dbuske 67. dbuske Lv 1 2 pts. 8,740
  8. Avatar for rinze 68. rinze Lv 1 2 pts. 8,737
  9. Avatar for drumpeter18yrs9yrs 69. drumpeter18yrs9yrs Lv 1 2 pts. 8,730
  10. Avatar for stomjoh 70. stomjoh Lv 1 2 pts. 8,700

Comments