Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Intermediate Pilot Pilot

Summary

Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,064
  2. Avatar for BCC 12. BCC 1 pt. 10,540
  3. Avatar for Stuyvesant Molecular Science 2017-18 13. Stuyvesant Molecular Science 2017-18 1 pt. 10,172
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 10,152
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,928
  1. Avatar for lconor 81. lconor Lv 1 1 pt. 10,358
  2. Avatar for cherry39 82. cherry39 Lv 1 1 pt. 10,353
  3. Avatar for parsnip 83. parsnip Lv 1 1 pt. 10,335
  4. Avatar for jebbiek 84. jebbiek Lv 1 1 pt. 10,335
  5. Avatar for dbuske 85. dbuske Lv 1 1 pt. 10,325
  6. Avatar for gstelle 86. gstelle Lv 1 1 pt. 10,291
  7. Avatar for lamoille 87. lamoille Lv 1 1 pt. 10,276
  8. Avatar for DipsyDoodle2016 88. DipsyDoodle2016 Lv 1 1 pt. 10,273
  9. Avatar for martinf 89. martinf Lv 1 1 pt. 10,259
  10. Avatar for cbwest 90. cbwest Lv 1 1 pt. 10,231

Comments